Phosl lectin
WebOct 5, 2012 · The purified lectin was designated as PhoSL ( P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH 2 -APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of … WebSep 14, 2024 · Biotinylated Pholiota Squarrosa lectin (PhoSL), which specifically recognizes core fucosylated N-glycans, was a generous gift from Dr. Yuka Kobayashi (J-oil Mills, Tokyo, Japan). Alexa Fluor® 647 ...
Phosl lectin
Did you know?
WebOct 29, 2015 · We earlier reported the purification of a mitogenic lectin from human pathogenic fungus Cephalosporium curvulum (CSL) that has complex sugar specificity when analysed by hapten inhibition assay. In the present study, we report the fine sugar specificity of CSL as determined by glycan array analysis. WebJul 6, 2024 · The lectin from a mushroom Pholiota squarrosa (PhoSL) shows a clear specificity to core fucosylation, without recognizing those with other types of …
Webfor PC detection (PhoSL-HP ELISA method 1) The lectin-antibody ELISA for fucosylated haptoglobin (PhoSL-HP) was performed as described previously [11]. Briefly, a 96-well ELISA plate was coated with the Fab frag-ment of anti-human HP IgG (Dako, Carpinteria, CA, USA), because IgG has fucosylated oligosaccharides in its Fc por- WebPhoSL-hIgG1 is a lectin fused to human IgG constant region and specifically binds to α1-6 fucosylated N-glycans only and not other types of fucosylated oligosaccharides, such as α1-2-, α1-3-, and α1-4-fucosylated glycans. ... and afucosylated CHO cells stained with the PhoSL-hIgG1 (right). Anti-hIg PE was used as secondary Ab. Price is $200 ...
WebMay 17, 2024 · The core α1–6 fucosylation-specific lectin from a mushroom Pholiota squarrosa (PhoSL) is a potential tool for precise diagnosis of cancers. This lectin consists of only 40 amino acids and can be chemically synthesized. We showed here that a synthesized PhoSL peptide formed a trimer by gel filtration and chemical cross-linking assays, and … WebFOLOTYN is a chemotherapy approved by the US Food & Drug Administration (FDA) for the treatment of relapsed or refractory PTCL. Relapsed — There was initial tumor shrinkage, …
WebJan 30, 2016 · Fucosylation levels of AGP using AAL and PhoSL lectins. Fucosylation levels of AGP were analysed with an enzyme-linked lectin assay (ELLA) using A. aurantia lectin (AAL) which recognizes fucoses α1-2, α1-3 or α1-6-linked [7] and with P. squarrosa lectin (PhoSL) which recognizes only α1-6-linked fucose [24]. Both assays were optimized with ...
flying wow shadowlandsWebFeb 27, 2024 · RCSB PDB - 6JK2: Crystal structure of a mini fungal lectin, PhoSL. Biological Assembly 1. 3D View : Structure 1D-3D View Electron Density Validation Report … flying w pheasant lodge plankinton sdWebJul 14, 2016 · PhoSL recognizes core fucose, whereas AAL recognizes all types of fucosylation. In normal controls, serum haptoglobin is scarcely fucosylated and core fucosylation levels of haptoglobin are increased at the stage of chronic pancreatitis. flying w photographhttp://www.phosal.com/products.html flying w pillsWebThe BLAST search revealed that PhoSL has 85% sequence homology (22/26 amino acids) with the ␣ 1– 6-linked fucose- specific lectin from R. stolonifer . RSL has also been isolated as a core... flying w prescription pillsWebOct 30, 2024 · To investigate functional loss by FUT8 gene ablation, lectin binding was tested using a lectin from the mushroom Pholiota squarrosa (PhoSL), which shows a specific binding property for core ... green mountain recovery center effingham nhWebMay 17, 2024 · This lectin showed an extreme stability against heat treatment, e.g., 100 °C for 30 min, and also against incubation at pH 2–11. PhoSL is therefore suitable for its use … green mountain recipes turkey